
Rat Secondary Antibodies
- (1)
- (3)
- (33)
- (1)
- (5)
- (54)
- (17)
- (56)
- (20)
- (13)
- (11)
- (29)
- (7)
- (1)
- (1)
- (1)
- (2)
- (13)
- (1)
- (12)
- (1)
- (7)
- (1)
- (1)
- (19)
- (1)
- (3)
- (1)
- (288)
- (1)
- (17)
- (4)
- (4)
- (1)
- (304)
- (1)
- (39)
- (2)
- (104)
- (46)
- (22)
- (63)
- (1)
- (16)
- (8)
- (3)
- (3)
- (1)
- (1)
- (285)
- (17)
Filtered Search Results

ZYAGEN LABS RAT REPRODUCTIVE
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
50-292-9378 RAT REPRODUCTIVE

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ZYAGEN LABS RAT LACRIMAL GLAND FROZEN SECS
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
50-292-9306 RAT LACRIMAL GLAND FROZEN SECS

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology APC Rabbit anti- CD162/PSGL-1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Involved in leukocyte adhesive activation Acts upstream of or within leukocyte tethering or rolling Predicted to be located in plasma membrane raft and uropod Predicted to be active in plasma membrane Is expressed in brain and thymus primordium Human ortholog(s) of this gene implicated in carotid artery disease Orthologous to human SELPLG (selectin P ligand)

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology PE/Cyanine7 anti-h CD90/Thy1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology PE/Cyanine7 anti-h CD90/Thy1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology APC/Cy7 anti-h/Mk CD8a
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain Both alpha and beta chains share significant homology to immunoglobulin variable light chains This gene encodes the CD8 alpha chain Multiple transcript variants encoding different isoforms have been found for this gene The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn-OH (trifluoroacetate salt) 0.5MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ONE-LETTER SEQUENCE: HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFNMOLECULAR FORMULA: C225H361N77O66S1MOLECULAR WEIGHT:5232.9STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [86472-71-1], RESEARCH AREA: HormonalREFERENCES: J. Spiess et al., Nature, 303, 532 (1983)

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
CPC Scientific H-Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH (trifluoroacetate salt) 1MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
ONE-LETTER SEQUENCE: SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Cys23 and 39 bridge)MOLECULAR FORMULA: C213H349N71O65S3MOLECULAR WEIGHT:5040.8STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [123337-89-3], SYNONYMS: BNP-45 (rat), Brain Natriuretic Peptide-45 (rat)RESEARCH AREA: CardiovascularREFERENCES: M. Aburaya et al., BBRC, 163, 226 (1989)

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology 450 anti-Human CD90/Thy1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology 594 anti-Human CD162/PSGL-1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P- E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes As such this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins This protein requires two post-translational modifications tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans for its high-affinity binding activity Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response Alternate splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology 488 Rabbit anti- CD162/PSGL-1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Involved in leukocyte adhesive activation Acts upstream of or within leukocyte tethering or rolling Predicted to be located in plasma membrane raft and uropod Predicted to be active in plasma membrane Is expressed in brain and thymus primordium Human ortholog(s) of this gene implicated in carotid artery disease Orthologous to human SELPLG (selectin P ligand)

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology APC anti-Human CD162/PSGL-1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P- E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes As such this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins This protein requires two post-translational modifications tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans for its high-affinity binding activity Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response Alternate splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology PE/Cy7 anti- Ly-6A/E Sca-1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity Acts upstream of or within response to bacterium Located in external side of plasma membrane Is expressed in alimentary system hindlimb tendon liver metanephros and physiological umbilical hernia Used to study osteoporosis Orthologous to human LY6H (lymphocyte antigen 6 family member H)

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology Human Lambda Light Chain
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Human Lambda Light Chain Rabbit mAb

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
ABclonal Technology APC anti-Human CD90/Thy1
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants

Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More